PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G29930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 642aa    MW: 71016.8 Da    PI: 6.1302
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G29930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.7e-094014381954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  OGLUM03G29930.1 401 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 438
                      664559******************************88 PP

2BELL120.29.1e-39264335172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e+qelq+k akL+ +l+eVd++Yk+y++q+q+v+ssF++vag g+akpYt++Al++iS+hFrcLkdai +qi
  OGLUM03G29930.1 264 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSSFDMVAGSGAAKPYTAVALQTISKHFRCLKDAINDQI 335
                      689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-56188333IPR006563POX domain
PfamPF075262.3E-51194331IPR006563POX domain
PROSITE profilePS5007112.357379442IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-28381451IPR009057Homeodomain-like
SMARTSM003891.6E-9382446IPR001356Homeobox domain
CDDcd000861.15E-12382443No hitNo description
SuperFamilySSF466892.99E-17383448IPR009057Homeodomain-like
PfamPF059201.0E-17399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MATYYSSPGN ERDSQAMYPA DSGNSSYPVP SAIGNMLYPG NGSSGPYTEF SGIIQHQQNF  60
MELPGHPTAI SQDSSSREPN MVASYTDQRS FGPAKDMRNE MLMHLMDGAH NAGADLIHND  120
THSSAQIEFG LLNNHNSMSV APAPGQGLSL SLNTHILAPS YPYWSAKTEL LTPHSYQGDD  180
NRMKNMQSEA SQAIRNSKYL KAAQELLDEV VSVWKSIKQK AQKDQAEAGK SDNKEAEGGS  240
KGEGVSSNPQ ESTANAAPEI SAAEKQELQN KMAKLMAMLD EVDRKYKHYY HQMQIVVSSF  300
DMVAGSGAAK PYTAVALQTI SKHFRCLKDA INDQINVIRK KLGEEESSSG KEGKLTRLRY  360
IDQQLRQQRA FQQYGLLQQN AWRPQRGLPE NSVSILRAWL FEHFLHPYPK DSEKLMLARQ  420
TGLTRSQISN WFINARVRLW KPMIEDMYKE EIGEADLDSN SSSDNVPRSK DKIATSEDKE  480
DLKSSMSQTY QPSQLGESKA NIGMMSLGGA PAGFHNEGNQ DDSFMNLMLK DQRPGEAEGS  540
LLHDAVAHHS DENARFMAYH LSGLGRYGNS NVSLTLGLQH PDNRLSVQNT HQPGFAGAGE  600
EIYNSTASLG VAAASSSDYE STNQIDQRQR FEPSPLMHDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16388445158Homeobox protein Meis1
4xrs_B2e-16388445158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0699940.0AK069994.1 Oryza sativa Japonica Group cDNA clone:J023038C04, full insert sequence.
GenBankFJ9402090.0FJ940209.1 Oryza sativa Japonica Group clone KCS181A11 homeodomain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631000.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0D9ZBM80.0A0A0D9ZBM8_9ORYZ; Uncharacterized protein
STRINGORGLA03G0273900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-113BEL1-like homeodomain 6